PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00006069-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 134aa    MW: 15425 Da    PI: 9.8925
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00006069-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.91.5e-2979129151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                         krien++ rqvtfskRr+g+lKKA+ELSvLC+aev vi+fs++g+lye+ss
  WALNUT_00006069-RA  79 KRIENTTSRQVTFSKRRHGLLKKAFELSVLCEAEVTVIVFSQKGRLYEFSS 129
                         79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.18871131IPR002100Transcription factor, MADS-box
SMARTSM004325.7E-3871130IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-2773131IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-307393IPR002100Transcription factor, MADS-box
CDDcd002652.06E-3573130No hitNo description
PROSITE patternPS00350073127IPR002100Transcription factor, MADS-box
PfamPF003194.5E-2580127IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-3093108IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-30108129IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
MLADLPYNAN HVTRSTPIGR EKKLLRCRHL IGFCFVLDSL TFWFGTSFPV VTSRAKEALV  60
FLEISLELED MVRGKIQMKR IENTTSRQVT FSKRRHGLLK KAFELSVLCE AEVTVIVFSQ  120
KGRLYEFSSS EYVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S7e-1771131161Myocyte-specific enhancer factor 2B
1tqe_R7e-1771131161Myocyte-specific enhancer factor 2B
1tqe_Q7e-1771131161Myocyte-specific enhancer factor 2B
1tqe_P7e-1771131161Myocyte-specific enhancer factor 2B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.45e-31AGAMOUS-like 42